PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J00345.1.p
Common NameEUGRSUZ_J00345
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Nin-like
Protein Properties Length: 192aa    MW: 22171.4 Da    PI: 8.7691
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J00345.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK66.83.2e-2199145450
            RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50 
                       +++l d+  yF+lpi++A+  L +c+Tv+K+iCR+ G+ RWP+Rki+
  Eucgr.J00345.1.p  99 KMTLADVGGYFHLPIEKASERLHLCPTVVKKICRKGGVGRWPYRKIQ 145
                       7999******************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.11987167IPR003035RWP-RK domain
PfamPF020421.2E-1899145IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MVSHAILDTQ HNPGAVPSNG EDRYQMFDFC KKSIQNVKDF LQQYCEGRRL AGYIMYQDPL  60
AMFYEAVCVG IDFNGNVNAD YFQLPLPPTV SVQRERAGKM TLADVGGYFH LPIEKASERL  120
HLCPTVVKKI CRKGGVGRWP YRKIQCIERK ILELREQLKR EDEPKRSRTQ AEIDEWQRNL  180
DKIRYGVART D*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J00345.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010024146.11e-136PREDICTED: protein RKD5-like
TrEMBLA0A059AAH11e-143A0A059AAH1_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40762342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.16e-10NIN like protein 7